PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00471g16035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family BES1
Protein Properties Length: 304aa    MW: 33346.3 Da    PI: 9.1208
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00471g16035.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822164.85.3e-51181372132
                    DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                               +++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+          g+kp+  +e++g+sa
  Peinf101Scf00471g16035.1  18 SGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWI----------GCKPT-PMEIGGTSA 91 
                               789********************************************************9..........79***.********* PP

                    DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsislas 132
                               +++p+ss + s+ ss++asp++sy++sp+sssfpsps++d ++++ 
  Peinf101Scf00471g16035.1  92 NITPSSSRNPSPPSSYFASPIPSYQPSPTSSSFPSPSRADANMSSY 137
                               ****************************************997763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.3E-4418134IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMWENGEGTT VQESNSNSGR RKPSWREREN NRRRERRRRA IAAKIYSGLR AQGNYNLPKH  60
CDNNEVLKAL CVEAGWIGCK PTPMEIGGTS ANITPSSSRN PSPPSSYFAS PIPSYQPSPT  120
SSSFPSPSRA DANMSSYPFA FLHNAIPSSL PPLRISNSAP VTPPLSSPTR HPKQTFNLET  180
LAKESMYALN IPFFAASSAP ASPTRGQRFT PPTIPECDES DTSTIDSGQW MSFQKYMTNV  240
PTSPTFNLVK PVGQPLPSYN MITDKGKSIE FGFENASVKA WEGERIHEVG VDELELTLGS  300
GSAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11938RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-175PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-106BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-153M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.24e-89BES1 family protein